Full name: tRNA yW-synthesizing enzyme 5
Synonym: C2orf60
GI: 89242134
Orf:
COG: KOG2130
UniProt: A2RUC4
Structures: | 3AL5 | 3AL6 |
Complex:
Enzyme type: hydroxylase
Position of modification - modification: t:37 - o2yW

Comments:

In mammals, Tyw5 catalyzes hydroxylation of a beta carbon in the lateral acp group of yW72 (the product of Tyw3 enzyme) to form hydroxyl derivative OHyW*. Reaction depends on Fe(II) ion and 2-oxoglutarate (2-OG) as cofactors. Homodimer. Catalytic domain consists of a β-jellyroll fold, a hallmark of the JmjC domains and other Fe(II)/2-OG oxygenases. Compound OHyW* is further transformed by the bifunctional Tyw4 enzyme into the final OHyW (hydroxywybutosine). Hydroxylated yW derivatives are absent in yeast.

Protein sequence:

MAGQHLPVPRLEGVSREQFMQHLYPQRKPLVLEGIDLGPCTSKWTVDYLSQVGGKKEVKIHVAAVAQMDF ISKNFVYRTLPFDQLVQRAAEEKHKEFFVSEDEKYYLRSLGEDPRKDVADIRKQFPLLKGDIKFPEFFKE EQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPL FSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILD RALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE

Publications:

Title Authors Journal Details PubMed Id DOI
Expanding role of the jumonji C domain as an RNA hydroxylase. Noma A, Ishitani R, Kato M, Nagao A, Nureki O, Suzuki T J Biol Chem [details] 20739293 -
Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification. Kato M, Araiso Y, Noma A, Nagao A, Suzuki T, Ishitani R, Nureki O Nucleic Acids Res [details] 20972222 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto