Full name: tRNA-specific adenosine deaminase 1
Synonym: hADAT1
GI: 302058269
Orf: ADAT1
COG:
UniProt: Q9BUB4
Structures: | |
Complex:
Enzyme type: deaminase
Position of modification - modification: t:37 - m1I

Comments:

Specifically deaminates adenosine 37 to inosine in exclusively cytoplasmic tRNA-Ala. The anticodon stem-loop of tRNAAla) alone is not a functional substrate for hADAT1.

Protein sequence:

MWTADEIAQLCYEHYGIRLPKKGKPEPNHEWTLLAAVVKIQSPADKACDTPDKPVQVTKEVVSMGTGTKC IGQSKMRKNGDILNDSHAEVIARRSFQRYLLHQLQLAATLKEDSIFVPGTQKGVWKLRRDLIFVFFSSHT PCGDASIIPMLEFEDQPCCPVFRNWAHNSSVEASSNLEAPGNERKCEDPDSPVTKKMRLEPGTAAREVTN GAAHHQSFGKQKSGPISPGIHSCDLTVEGLATVTRIAPGSAKVIDVYRTGAKCVPGEAGDSGKPGAAFHQ VGLLRVKPGRGDRTRSMSCSDKMARWNVLGCQGALLMHLLEEPIYLSAVVIGKCPYSQEAMQRALIGRCQ NVSALPKGFGVQELKILQSDLLFEQSRSAVQAKRADSPGRLVPCGAAISWSAVPEQPLDVTANGFPQGTT KKTIGSLQARSQISKVELFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQVFGS WIRNPPDYHQFK

Enzymatic activities:

Reaction Substrate Type Position
A:I tRNA (t) Ala/IGC/unknown 37

Publications:

Title Authors Journal Details PubMed Id DOI
Identification and characterization of a human tRNA-specific adenosine deaminase related to the ADAR family of pre-mRNA editing enzymes. Maas S, Gerber AP, Rich A... Proc Natl Acad Sci U S A [details] 10430867 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto