Full name: tRNA (uracil-5-)-methyltransferase
Synonym: Nud1, Rnc1
GI: 110825750
Orf: YKR056W
COG: COG2265
UniProt: P33753
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:54 - m5U

Comments:

AdoMet is the methyl group donor. Site-specific. Contains 1 TRAM domain.

Protein sequence:

MYEQFEFSFFFFENSDNKVKYKAHLISSIKRWSIITCMRCFWTVQKSIFKARFFACRNFVKKHNYKLIST MTGSTEMVPPTMKHTVDNKRLSSPLTDSGNRRTKKPKLRKYKAKKVETTSPMGVLEFEVNDLLKSQNLSR EQVLNDVTSILNDKSSTDGPIVLQYHREVKNVKVLEITSNGNGLALIDNPVETEKKQVVIIPFGLPGDVV NIKVFKTHPYYVESDLLDVVEKSPMRRDDLIRDKYFGKSSGSQLEFLTYDDQLELKRKTIMNAYKFFAPR LVAEKLLPPFDTTVASPLQFGYRTKITPHFDMPKRKQKELSVRPPLGFGQKGRPQWRKDTLDIGGHGSIL DIDECVLATEVLNKGLTNERRKFEQEFKNYKKGATILLRENTTILDPSKPTLEQLTEEASRDENGDISYV EVEDKKNNVRLAKTCVTNPRQIVTEYVDGYTFNFSAGEFFQNNNSILPIVTKYVRDNLQAPAKGDDNKTK FLVDAYCGSGLFSICSSKGVDKVIGVEISADSVSFAEKNAKANGVENCRFIVGKAEKLFESIDTPSENTS VILDPPRKGCDELFLKQLAAYNPAKIIYISCNVHSQARDVEYFLKETENGSAHQIESIRGFDFFPQTHHV ESVCIMKRI

Enzymatic activities:

Reaction Substrate Type Position
U:m5U tRNA (t) Ala/IGC/prokaryotic cytosol 54
U:m5U tRNA (t) Arg/ACU/prokaryotic cytosol 54
U:m5U tRNA (t) Arg/ICG/prokaryotic cytosol 54
U:m5U tRNA (t) Asn/GUU/prokaryotic cytosol 54
U:m5U tRNA (t) Asp/GUC/prokaryotic cytosol 54
U:m5U tRNA (t) Cys/GCA/prokaryotic cytosol 54
U:m5U tRNA (t) Glu/CUC/prokaryotic cytosol 54
U:m5U tRNA (t) Gly/GCC/prokaryotic cytosol 54
U:m5U tRNA (t) Gly/{CC/prokaryotic cytosol 54
U:m5U tRNA (t) His/GUG/prokaryotic cytosol 54
U:m5U tRNA (t) Ile/IAU/prokaryotic cytosol 54
U:m5U tRNA (t) Ile/UAU/prokaryotic cytosol 54
U:m5U tRNA (t) Leu/UAG/prokaryotic cytosol 54
U:m5U tRNA (t) Leu/CAA/prokaryotic cytosol 54
U:m5U tRNA (t) Leu/UAA/prokaryotic cytosol 54
U:m5U tRNA (t) Lys/CUU/prokaryotic cytosol 54
U:m5U tRNA (t) Lys/SUU/prokaryotic cytosol 54
U:m5U tRNA (t) Met/CAU/prokaryotic cytosol 54
U:m5U tRNA (t) Phe/GAA/prokaryotic cytosol 54
U:m5U tRNA (t) Pro/UGG/prokaryotic cytosol 54
U:m5U tRNA (t) Ser/CGA/prokaryotic cytosol 54
U:m5U tRNA (t) Ser/UGA/prokaryotic cytosol 54
U:m5U tRNA (t) Ser/IGA/prokaryotic cytosol 54
U:m5U tRNA (t) Thr/IGU/prokaryotic cytosol 54
U:m5U tRNA (t) Trp/CCA/prokaryotic cytosol 54
U:m5U tRNA (t) Val/CAC/prokaryotic cytosol 54
U:m5U tRNA (t) Val/UAC/prokaryotic cytosol 54
U:m5U tRNA (t) Val/IAC/prokaryotic cytosol 54
U:m5U tRNA (t) Arg/UCU/mitochondrial 54
U:m5U tRNA (t) Arg/ACG/mitochondrial 54
U:m5U tRNA (t) Gly/UCC/mitochondrial 54
U:m5U tRNA (t) His/GUG/mitochondrial 54
U:m5U tRNA (t) Ile/GAU/mitochondrial 54
U:m5U tRNA (t) Leu/UAA/mitochondrial 54
U:m5U tRNA (t) Lys/UUU/mitochondrial 54
U:m5U tRNA (t) Met/CAU/mitochondrial 54
U:m5U tRNA (t) Pro/UGG/mitochondrial 54
U:m5U tRNA (t) Ser/GCU/mitochondrial 54
U:m5U tRNA (t) Ser/UGA/mitochondrial 54
U:m5U tRNA (t) Thr/UAG/mitochondrial 54
U:m5U tRNA (t) Trp/UCA/mitochondrial 54
U:m5U tRNA (t) Tyr/GUA/mitochondrial 54
U:m5U tRNA (t)   54

Publications:

Title Authors Journal Details PubMed Id DOI
Identification of the TRM2 gene encoding the tRNA(m5U54)methyltransferase of Saccharomyces cerevisiae. Nordlund ME, Johansson JO, von Pawel-Rammingen U, Bystrom AS RNA [details] 10864043 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto