Full name: tRNA (cytidine(32)-2′-O)-methyltransferase
Synonym: Saci_0621
GI: 70606436
Orf:
COG: COG0565
UniProt: Q4JB16
Structures: | 4CNF | 4CNG |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:32 - Cm

Comments:

Homolog of E. coli TrmJ. While the four canonical nucleosides are substrates of the Escherichia coli enzyme, the archaeal TrmJ can only methylate the ribose of a cytidine.

Protein sequence:

MTIRLVIVEPEGAYNLGFIARLVKNFLIDEFYVVNPKCDINEAIKFSAKGSEVIEKMMKITNNFDDAIRD VDLKIATSSIADIKGDLLRKSIRPIDLERLIKDKKVAFIFGRESVGLTREEIAKSDFLLFIPANPEYPVL NLSHAVGIVLYELWRNRDNKVPTVSSEPIKLIDDYSKKITDILVNKEATKSMYLVLKRVLIKGIEDNEEA MTIVRILRKIYVRLAKKENESDKLL

Enzymatic activities:

Reaction Substrate Type Position
C:Cm tRNA (t) 32

Publications:

Title Authors Journal Details PubMed Id DOI
Characterization of two homologous 2'-O-methyltransferases showing different specificities for their tRNA substrates. Somme J, Van Laer B, Roovers M, Steyaert J, Versees W, Droogmans L... RNA [details] 24951554 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto