Full name: 5-methylcytosine rRNA methyltransferase NSUN4, mitochondrial
Synonym: NOL1/NOP2/Sun domain family member 4
GI: 370879165
Orf:
COG:
UniProt:
Structures: | 4FP9 |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: s:841(None) - m5C

Comments:



Protein sequence:

MAALTLRGVRELLKRVDLATVPRRHRYKKKWAATEPKFPAVRLALQNFDMTYSVQFGDLW PSIRVSLLSEQKYGALVNNFAAWDHVSAKLEQLSAKDFVNEAISHWELQSEGGQSAAPSP ASWACSPNLRCFTFDRGDISRFPPARPGSLGVMEYYLMDAASLLPVLALGLQPGDIVLDL CAAPGGKTLALLQTGCCRNLAANDLSPSRIARLQKILHSYVPEEIRDGNQVRVTSWDGRK WGELEGDTYDRVLVDVPCTTDRHSLHEEENNIFKRSRKKERQILPVLQVQLLAAGLLATK PGGHVVYSTCSLSHLQNEYVVQGAIELLANQYSIQVQVEDLTHFRRVFMDTFCFFSSCQV GELVIPNLMANFGPMYFCKMRRLT

Publications:

Title Authors Journal Details PubMed Id DOI
NSUN4 is a dual function mitochondrial protein required for both methylation of 12S rRNA and coordination of mitoribosomal assembly. Metodiev MD, Spåhr H, Loguercio Polosa P, Meharg C, Becker C, Altmueller J, Habermann B, Larsson NG, Ruzzenente B. PLoS Genet. [details] 24516400 10.1371/journal.pgen.1004110
Structure of the human MTERF4-NSUN4 protein complex that regulates mitochondrial ribosome biogenesis. Spåhr H, Habermann B, Gustafsson CM, Larsson NG, Hallberg BM. Proc Natl Acad Sci U S A [details] 22949673 10.1073/pnas.1210688109
MTERF4 regulates translation by targeting the methyltransferase NSUN4 to the mammalian mitochondrial ribosome. Cámara Y, Asin-Cayuela J, Park CB, Metodiev MD, Shi Y, Ruzzenente B, Kukat C, Habermann B, Wibom R, Hultenby K, Franz T, Erdjument-Bromage H, Tempst P, Hallberg BM, Gustafsson CM, Larsson NG. Cell Metab. [details] 21531335 10.1016/j.cmet.2011.04.002
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto