Full name: tRNA (cytidine(32)/guanosine(34)-2′-O)-methyltransferase
Synonym: Ybr1, FtsJ
GI: 586500
Orf: YBR061C
COG: COG0293
UniProt: P38238
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:34 - Gm
t:34 - ncm5Um
t:32 - Cm

Comments:

Carries out two succesive methylations of anticodon. Activity is stimulated by a not yet identified protein-cofactor (Lecointe, Grosjean, unpublished results).

Protein sequence:

MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQVLSRKLFDESP SSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADFVCSDGAPDVTGLHDLDEYVQ QQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYLFDKIVCAKPRSSRGTSLEAFIVCLGYNPP SNWTPKLDVNTSVDEFFQGCFLNKLCISDKLSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTS SSLDPVQSPTNPPYKKALELKRSGKLTRSV

Enzymatic activities:

Reaction Substrate Type Position
C:Cm tRNA (t) Phe/GAA/prokaryotic cytosol 32
G:Gm tRNA (t) Phe/GAA/prokaryotic cytosol 34
C:Cm tRNA (t) Trp/CCA/prokaryotic cytosol 32
C:Cm tRNA (t) Trp/CCA/prokaryotic cytosol 34
C:Cm tRNA (t) Leu/UAA/prokaryotic cytosol 32
ncm5U:ncm5Um tRNA (t) Leu/UAA/prokaryotic cytosol 34

Publications:

Title Authors Journal Details PubMed Id DOI
Trm7p catalyses the formation of two 2'-O-methylriboses in yeast tRNA anticodon loop. Pintard L, Lecointe F, Bujnicki JM, Bonnerot C, Grosjean H, Lapeyre B EMBO J [details] 11927565 -
Yeast Trm7 interacts with distinct proteins for critical modifications of the tRNAPhe anticodon loop. Guy MP, Podyma BM, Preston MA, Shaheen HH, Krivos KL, Limbach PA, Hopper AK, Phizicky EM... RNA [details] 22912484 -
Conservation of an intricate circuit for crucial modifications of the tRNAPhe anticodon loop in eukaryotes. Guy MP, Phizicky EM... RNA [details] 25404562 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto