Modomics - A Database of RNA Modifications

Full name:	tRNA (cytidine(32)/guanosine(34)-2′-O)-methyltransferase
Synonym:	Ybr1, FtsJ
GI:	586500
Orf:	YBR061C
COG:	COG0293
UniProt:	P38238
Structures:	\| \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	t:32 - Cm t:34 - Gm t:34 - ncm5Um

Comments:

Carries out two succesive methylations of anticodon. Activity is stimulated by a not yet identified protein-cofactor (Lecointe, Grosjean, unpublished results).

Protein sequence:

MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQVLSRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADI
THPKTLARILKLFGNEKADFVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYLFDKIVCAKPRSSRGTSLEA
FIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLNKLCISDKLSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYKKALEL
KRSGKLTRSV

Enzymatic activities:

Reaction	Substrate	Type	Position
C:Cm	tRNA (t)	Phe/GAA/prokaryotic cytosol	32
G:Gm	tRNA (t)	Phe/GAA/prokaryotic cytosol	34
C:Cm	tRNA (t)	Trp/CCA/prokaryotic cytosol	32
C:Cm	tRNA (t)	Trp/CCA/prokaryotic cytosol	34
C:Cm	tRNA (t)	Leu/UAA/prokaryotic cytosol	32
ncm5U:ncm5Um	tRNA (t)	Leu/UAA/prokaryotic cytosol	34

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Trm7p catalyses the formation of two 2'-O-methylriboses in yeast tRNA anticodon loop.	Pintard L, Lecointe F, Bujnicki JM, Bonnerot C, Grosjean H, Lapeyre B	EMBO J	[details]	11927565	-
Yeast Trm7 interacts with distinct proteins for critical modifications of the tRNAPhe anticodon loop.	Guy MP, Podyma BM, Preston MA, Shaheen HH, Krivos KL, Limbach PA, Hopper AK, Phizicky EM...	RNA	[details]	22912484	-
Conservation of an intricate circuit for crucial modifications of the tRNAPhe anticodon loop in eukaryotes.	Guy MP, Phizicky EM...	RNA	[details]	25404562	-

Links:

_PubMed_

_PubMed_