MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQVLSRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADI THPKTLARILKLFGNEKADFVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYLFDKIVCAKPRSSRGTSLEA FIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLNKLCISDKLSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYKKALEL KRSGKLTRSV
Reaction | Substrate | Type | Position |
---|---|---|---|
C:Cm | tRNA (t) | Phe/GAA/prokaryotic cytosol | 32 |
G:Gm | tRNA (t) | Phe/GAA/prokaryotic cytosol | 34 |
C:Cm | tRNA (t) | Trp/CCA/prokaryotic cytosol | 32 |
C:Cm | tRNA (t) | Trp/CCA/prokaryotic cytosol | 34 |
C:Cm | tRNA (t) | Leu/UAA/prokaryotic cytosol | 32 |
ncm5U:ncm5Um | tRNA (t) | Leu/UAA/prokaryotic cytosol | 34 |
Title | Authors | Journal | Details | ||
---|---|---|---|---|---|
Trm7p catalyses the formation of two 2'-O-methylriboses in yeast tRNA anticodon loop. | Pintard L, Lecointe F, Bujnicki JM, Bonnerot C, Grosjean H, Lapeyre B | EMBO J | [details] | 11927565 | - |
Yeast Trm7 interacts with distinct proteins for critical modifications of the tRNAPhe anticodon loop. | Guy MP, Podyma BM, Preston MA, Shaheen HH, Krivos KL, Limbach PA, Hopper AK, Phizicky EM... | RNA | [details] | 22912484 | - |
Conservation of an intricate circuit for crucial modifications of the tRNAPhe anticodon loop in eukaryotes. | Guy MP, Phizicky EM... | RNA | [details] | 25404562 | - |
_PubMed_ |