| Full name: | N6-adenosine-methyltransferase MT-A70-like | 
|---|---|
| GI: | 1063721623 | 
| UniProt: | O82486 | 
| Alpha Fold Predicted Structure: | AF-O82486-F1 | 
| Enzyme type: | methyltransferase | 
METESDDATITVVKDMRVRLENRIRTQHDAHLDLLSSLQSIVPDIVPSLDLSLKLISSFTNRPFVATPPLPEPKVEKKHHPIVKLGTQLQQLHGHDSKSMLVDSNQRDAEADGSSGSPMALVRAMVAECLLQRVPFSPTDSSTVLRKLENDQNARPAEKAALRDLGGECGPILAVETALKSMAEENGSVELEEFEVSGKPRIMVLAIDRTRLLKELPESFQGNNESNRVVETPNSIENATVSGGGFGVSGSGNFPRPEMWGGDPNMGFRPMMNAPRGMQMMGMHHPMGIMGRPPPFPLPLPLPVPSNQKLRSEEEDLKDVEALLSKKSFKEKQQSRTGEELLDLIHRPTAKEAATAAKFKSKGGSQVKYYCRYLTKEDCRLQSGSHIACNKRHFRRLIASHTDVSLGDCSFLDTCRHMKTCKYVHYELDMADAMMAGPDKALKPLRADYCSEAELGEAQWINCDIRSFRMDILGTFGVVMADPPWDIHMELPYGTMADDEMRTLNVPSLQTDGLIFLWVTGRAMELGRECLELWGYKRVEEIIWVKTNQLQRIIRTGRTGHWLNHSKEHCLVGIKGNPEVNRNIDTDVIVAEVRETSRKPDEMYAMLERIMPRARKLELFARMHNAHAGWLSLGNQLNGVRLINEGLRARFKASYPEIDVQPPSPPRASAMETDNEPMAIDSITA
The components required for m6A in Arabidopsis included MTA, MTB, FIP37, VIRILIZER and the E3 ubiquitin ligase HAKAI. Downregulation of these proteins led to reduced relative m6A levels and shared pleiotropic phenotypes, which included aberrant vascular formation in the root, indicating that correct m6A methylation plays a role in developmental decisions during pattern formation.
| Alpha Fold Pdb Files | AF-O82486-F1.pdb   | 
| Alpha Fold Pdbx/mmCIF Files | AF-O82486-F1.cif   | 
| DSSP Secondary Structures | O82486.dssp   | 
| Title | Authors | Journal | Details | ||
|---|---|---|---|---|---|
| MTA is an Arabidopsis messenger RNA adenosine methylase and interacts with a homolog of a sex-specific splicing factor. | Zhong S, Li H, Bodi Z, Button J, Vespa L, Herzog M, Fray RG | Plant Cell | [details] | 18505803 | 10.1105/tpc.108.058883 | 
| Identification of factors required for m(6) A mRNA methylation in Arabidopsis reveals a role for the conserved E3 ubiquitin ligase HAKAI. | Růžička K, Zhang M, Campilho A, Bodi Z, Kashif M, Saleh M, Eeckhout D, El-Showk S, Li H, Zhong S, De Jaeger G, Mongan NP, Hejátko J, Helariutta Y, Fray RG | New Phytol. | [details] | 28503769 | 10.1111/nph.14586 | 
| Unique Features of the m6A Methylome in Arabidopsis thaliana | Guan-Zheng Luo, Alice MacQueen, Guanqun Zheng, Hongchao Duan, Louis C Dore, Zhike Lu, Jun Liu, Kai Chen, Guifang Jia, Joy Bergelson, Chuan He | Nat Commun. | [details] | 25430002 | 10.1038/ncomms6630 |