Full name: adenosine deaminase, tRNA specific 2
Synonym: dJ20N2.1, TAD2
GI: None
Orf:
COG:
UniProt:
Structures: | Q7Z6V5 |
Complex:
Enzyme type: deaminase
Position of modification - modification:

Comments:



Protein sequence:

>sp|Q7Z6V5|ADAT2_HUMAN tRNA-specific adenosine deaminase 2 OS=Homo sapiens OX=9606 GN=ADAT2 PE=1 SV=1 MEAKAAPKPAASGACSVSAEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRN EVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIP LVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPK SKVRKKECQKS

Publications:

Title Authors Journal Details PubMed Id DOI
RNA editing by adenosine deaminases generates RNA and protein diversity. Schaub M, Keller W... Biochimie [details] 12457566 -
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto