Full name: adenosine deaminase, tRNA specific 3
Synonym: TAD3
GI: None
Orf:
COG:
UniProt:
Structures: | Q96EY9 |
Complex:
Enzyme type: deaminase
Position of modification - modification:

Comments:



Protein sequence:

>sp|Q96EY9|ADAT3_HUMANProbableinactivetRNA-specificadenosinedeaminase-likeprotein3OS=HomosapiensOX=9
606GN=ADAT3PE=1SV=1MEPAPGLVEQPKCLEAGSPEPEPAPWQALPVLSEKQSGDVELVLAYAAPVLDKRQTSRLLKEVSALHPLPAQPHLKRVRPS
RDAGSPHALEMLLCLAGPASGPRSLAELLPRPAVDPRGLGQPFLVPVPARPPLTRGQFEEARAHWPTSFHEDKQVTSALAGRLFSTQERAAMQSHMERAV
WAARRAAARGLRAVGAVVVDPASDRVLATGHDCSCADNPLLHAVMVCVDLVARGQGRGTYDFRPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYLCTG
YDLYVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLDPDT


Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca