Full name: adenosine deaminase, tRNA specific 3
Synonym: TAD3
GI: None
Orf:
COG:
UniProt:
Structures: | Q96EY9 |
Complex:
Enzyme type: deaminase
Position of modification - modification:

Comments:



Protein sequence:

>sp|Q96EY9|ADAT3_HUMAN Probable inactive tRNA-specific adenosine deaminase-like protein 3 OS=Homo sapiens OX=9606 GN=ADAT3 PE=1 SV=1 MEPAPGLVEQPKCLEAGSPEPEPAPWQALPVLSEKQSGDVELVLAYAAPVLDKRQTSRLL KEVSALHPLPAQPHLKRVRPSRDAGSPHALEMLLCLAGPASGPRSLAELLPRPAVDPRGL GQPFLVPVPARPPLTRGQFEEARAHWPTSFHEDKQVTSALAGRLFSTQERAAMQSHMERA VWAARRAAARGLRAVGAVVVDPASDRVLATGHDCSCADNPLLHAVMVCVDLVARGQGRGT YDFRPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVH ARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLDPDT
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto