Full name: alkB homolog 4, lysine demethylase
Synonym: FLJ20013
GI: None
Orf: None
COG: None
UniProt: Q9NXW9
Structures: | |
Complex: None

Comments:

None

Protein sequence:

MAAAAAETPEVLRECGCKGIRTCLICERQRGSDPPWELPPAKTYRFIYCSDTGWAVGTEESDFEGWAFPFPGVMLIEDFVTREEEAELVRLMDRDPWKLS
QSGRRKQDYGPKVNFRKQKLKTEGFCGLPSFSREVVRRMGLYPGLEGFRPVEQCNLDYCPERGSAIDPHLDDAWLWGERLVSLNLLSPTVLSMCREAPGS
LLLCSAPSAAPEALVDSVIAPSRSVLCQEVEVAIPLPARSLLVLTGAARHQWKHAIHRRHIEARRVCVTFRELSAEFGPGGRQQELGQELLRIALSFQGR
PV


Diseases connected to this enzyme:

Description Reaction Disease Name
Demethylated tRNA is more sensitive to angiogenin that mediates the cleavage of tRNAs, so tRNA-derived small RNAs are involved in ALKBH3-induced cancer progression by preventing apoptosis of cancer cells. A:m1A
Cancer (not specified)

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca