Full name: Y-box binding protein 1
Synonym: YB-1,YB1,DBPB,NSEP-1,MDR-NF1,BP-8,CSDB,CSDA2
GI: None
Orf: None
COG: None
UniProt: P67809
Structures: | 6kug |
Complex: None

Comments:

None

Protein sequence:

MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYL
RSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRR
PYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDG
KETKAADPPAENSSAPEAEQGGAE


Diseases connected to this enzyme:

Description Reaction Disease Name
NSUN2 and YBX1 stabilize the oncogene mRNA of the oncogene HDGF that mediates UCB pathogenesis in human C:m5C
Urothelial carcinoma of the bladder (UCB)

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca