Full name: apolipoprotein B mRNA editing enzyme catalytic subunit 3A
Synonym: ARP3,PHRBN
GI: None
Orf: None
COG: None
UniProt: P31941
Structures: | 2m65 |
Complex: None

Comments:

None

Protein sequence:

MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKNLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSP
CFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQGN


Diseases connected to this enzyme:

Description Reaction Disease Name
RNA editing of A3A induces changes in WT1 mRNA which correspond to driver cancer mutations suggests a potential role for this novel modification in cancer mutagenesis C:U
Wilms tumor and
RNA editing of A3A induces changes in WT1 mRNA which correspond to driver cancer mutations suggests a potential role for this novel modification in cancer mutagenesis C:U
Acute Myeloid Leukemia

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca