Modomics - A Database of RNA Modifications

Full name:	apolipoprotein B mRNA editing enzyme catalytic subunit 3A
Synonym:	ARP3,PHRBN
GI:	None
Orf:	None
COG:	None
UniProt:	P31941
Structures:	\| 2m65 \|
Complex:	None

Comments:

None

Protein sequence:

MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKNLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSP
CFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQGN

Diseases connected to this enzyme:

Description	Reaction	Disease Name
RNA editing of A3A induces changes in WT1 mRNA which correspond to driver cancer mutations suggests a potential role for this novel modification in cancer mutagenesis	C:U	Wilms tumor and
RNA editing of A3A induces changes in WT1 mRNA which correspond to driver cancer mutations suggests a potential role for this novel modification in cancer mutagenesis	C:U	Acute Myeloid Leukemia