Full name: TLE family member 5, transcriptional modulator
Synonym: GRG5
GI: None
Orf: None
COG: None
UniProt: Q08117
Structures: | |
Complex: None

Comments:

None

Protein sequence:

MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEH
QQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD


Diseases connected to this enzyme:

Description Reaction Disease Name
Loss of 2'-O-Me results in decreased leukemia self-renewal potential and reduced colony formation potential. xX:Xm
Leukemia

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca