Full name: Multisite-specific tRNA:(cytosine-C(5))-methyltransferase trm4a
Synonym: Multisite-specific tRNA:(cytosine-C(5))-methyltransferase trm4a
GI: None
Orf:
COG:
UniProt: Q9HGQ2
Structures: | |
Complex: none
Enzyme type: methyltransferase
Position of modification - modification:

Comments:



Protein sequence:

MGRKHYSSKKNRSKKGEFVNWDLIERKNENFEKYYRLQKLVTEDDFILLKQKLTEQLPTTFRITASIPHATQVRDYFIEHYYPLIENARTEDAKIPLPVS
LPWYPDGMAFMLDISKEVIRKSPHLKALQEFLVLETEAGDINRQESVSMVPPLLLNVESHHKVLDMCAAPGSKTAQLLEALHKPTKKEDITTLLPSGIVI
ANDSDNKRAHMLVHQIKRLNSPNVLIVNHDASFLPNFHLSSPDGKKFLKFDRILADVPCSGDGTFRKNIALWNEWSLKTALGLHATQIKILMRGLQLLEK
GGRLVYSTCSLNPIENEAVVSAVLNATRGSVRLVDVSSELPQLKRSQGVDNWVVCDSDLNIYPSFDTLPKELYEKMPPTLWPLPKKELAELNIQNCLRIY
PHFQNTGGFFVAVLEKYENLTSSMKTAVDDNKVFLREQKLPSEQASKKRKQDTQETSSDSKLAEVKPKGKNGGNRFHELDPFVYIKEDDQALEKIYKKFG
IDEAIIKKNQFFVRNVNGVPTKAIYISNDLFRNVIENNRNRVKFVHGGLKIFVRQDFGSLSREIAEKNGTCVFRVQSDGANLASHFIAESCLFHTTLSDL
FILLDHEAVTIDDFPEDSLFRKEYNHLDLGSTLLHVDLAKEESVIKKQVYIPLWKSVRICNVLLSNSEKRTLKLQIEGPQSSIHKHNT

Publications:

Title Authors Journal Details PubMed Id DOI
Division of labour: tRNA methylation by the NSun2 tRNA methyltransferases Trm4a and Trm4b in fission yeast. Martin Müller,Anke Samel-Pommerencke,Carine Legrand,Francesca Tuorto,Frank Lyko,Ann E Ehrenhofer-Murray RNA Biol [details] 30646830 -
Pmt1, a Dnmt2 homolog in Schizosaccharomyces pombe, mediates tRNA methylation in response to nutrient signaling. Maria Becker,Sara Müller,Wolfgang Nellen,Tomasz P Jurkowski,Albert Jeltsch,Ann E Ehrenhofer-Murray Nucleic Acids Res [details] 23074192 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca