Full name: tRNA (uridine(54)-C5)-methyltransferase
Synonym: RumT
GI: 136247
Orf: b3965
COG: COG2265
UniProt: P23003
Structures: | 3BT7 |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:54 - m5U

Comments:

AdoMet is the methyl group donor.

Protein sequence:

MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDLVPEVFRSPVSHYRMRAEFRIWHDGDDLYHIIFDQQTKS RIRVDSFPAASELINQLMTAMIAGVRNNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKLDDEWRQEAEALR DALRAQNLNVHLIGRATKTKIELDQDYIDERLPVAGKEMIYRQVENSFTQPNAAMNIQMLEWALDVTKGS KGDLLELYCGNGNFSLALARNFDRVLATEIAKPSVAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREF NRLQGIDLKSYQCETIFVDPPRSGLDSETEKMVQAYPRILYISCNPETLCKNLETLSQTHKVERLALFDQ FPYTHHMECGVLLTAK

Enzymatic activities:

Reaction Substrate Type Position
U:m5U tRNA (t)   54

Publications:

Title Authors Journal Details PubMed Id DOI
Cloning and restriction mapping of the trmA gene coding for transfer ribonucleic acid (5-methyluridine)-methyltransferase in Escherichia coli K-12. Ny T, Bjork GR J Bacteriol [details] 6247318 -
Structure of a TrmA-RNA complex: A consensus RNA fold contributes to substrate selectivity and catalysis in m5U methyltransferases. Alian A, Lee TT, Griner SL, Stroud RM, Finer-Moore J Proc Natl Acad Sci U S A [details] 18451029 -

Links:

_MetaCyc_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto