ID Card:
    
        
            
                | Full name:  | 
                Fibrillarin-like rRNA/tRNA 2′-O-methyltransferase | 
            
            
            
                | Synonym:  | 
                aFib, Fibrillarin-like | 
            
            
            
            
            
            
            
            
                | UniProt:  | 
                D4GZN3 | 
            
            
            
            
            
            
                | Complex:  | 
                C/D RNP | 
            
            
            
            
                | Enzyme type:  | 
                 | 
            
            
                
                    |  Position of modification - modification:  | 
                    
                        
                            t:None - Cm  
                            
                            t:None - Um  
                            
                         | 
                
                    
            
            
            
            
                | Level of experimental evidence:  | 
                5 | 
            
            
            
            
                | Level of experimental reliability:  | 
                5 | 
            
            
        
      
    
  
Protein sequence:
        
        
            
                
                    MSDDGSAADAALPDGVERRTFGGRERLSTRGEPVYGEPVDSDGWRAWDAGRSKLGAMLELGMDTGLVGGESVLYLGAASGTTVSHVADFAGPTYAVEFAPRPVRDLVGVAEDRDNLFPLLKDARDPDSYAHVVEAGIDCLVMDVATRGQATVAVRNRQFLADDGRLLMAVKARSEDVTAEPDDVFDDVIAELDSAYELLETARLDRFHADHLGIVARPK
                
                
             
         
        
Comments: 
Involved in pre-rRNA and tRNA processing. Utilizes the methyl donor S-adenosyl-L-methionine to catalyze the site-specific 2'-hydroxyl methylation of ribose moieties in rRNA and tRNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA.
    
        
            
            
                | Reaction | 
                Substrate | 
                SubstrateType | 
                Position | 
                (Anti)Codon | 
                Modified (Anti)Codon | 
                Amino Acid Change | 
                Transcript Name | 
                Transcript Region | 
                Cellular Localization | 
                
               
                References | 
            
            
            
            
            
                | 
                    
                    
                    
                        C:Cm
                    
                 | 
                
                tRNA (t) | 
                
                
                tRNA/tRNA/prokaryotic cytosol | 
                
                34 | 
                  | 
                  | 
                  | 
                  | 
                  | 
                  | 
                
                
                 | 
            
            
            
                | 
                    
                    
                    
                        U:Um
                    
                 | 
                
                tRNA (t) | 
                
                
                tRNA/tRNA/prokaryotic cytosol | 
                
                39 | 
                  | 
                  | 
                  | 
                  | 
                  | 
                  | 
                
                
                 | 
            
            
            
        
    
Publications:
    
    
        | Title | 
        Authors | 
        Journal | 
        Details | 
        PubMed Id | 
        DOI | 
    
    
    
    
    
        | RNomics and Modomics in the halophilic archaea Haloferax volcanii: identification of RNA modification genes. | 
        Grosjean H; Gaspin C; Marck C; Decatur WA; de Crécy-Lagard V | 
        BMC Genomics | 
        
            [details]
         | 
        
            18844986
            
         | 
        
              10.1186/1471-2164-9-470 
            
         |