Full name: | tRNA (cytidine(56)-2'-O)-methyltransferase |
---|---|
Synonym: | HVO_1173 |
UniProt: | D4GWS4 |
Enzyme type: | |
Position of modification - modification: |
t:None - Cm |
Level of experimental evidence: | 5 |
Level of experimental reliability: | 5 |
MHNEPEVAVLRYGHRPGRDDRMTTHVGLTARALGADRVILPDNAGHSMETVEDITGRFGGPFEVELTEALNGVIRNWEGRVVHLTMYGERVQDVEADIREAHAEEPLLVVVGGEKVPFEVYEGADWNVGVTNQPHSEVAGLAVFLDRLFDGRELDREWEDAENRVVPMATGKKVVPADEE
All tRNA types
Reaction | Substrate | SubstrateType | Position | (Anti)Codon | Modified (Anti)Codon | Amino Acid Change | Transcript Name | Transcript Region | Cellular Localization | References |
---|---|---|---|---|---|---|---|---|---|---|
C:Cm | tRNA (t) | tRNA/tRNA/prokaryotic cytosol | 56 |
Title | Authors | Journal | Details | ||
---|---|---|---|---|---|
RNomics and Modomics in the halophilic archaea Haloferax volcanii: identification of RNA modification genes. | Grosjean H; Gaspin C; Marck C; Decatur WA; de Crécy-Lagard V | BMC Genomics | [details] | 18844986 | 10.1186/1471-2164-9-470 |