| Full name: | tRNA (cytidine(56)-2'-O)-methyltransferase | 
|---|---|
| Synonym: | HVO_1173 | 
| UniProt: | D4GWS4 | 
| Enzyme type: | |
| Position of modification - modification: | 
                            t:None - Cm  | 
                
| Level of experimental evidence: | 5 | 
| Level of experimental reliability: | 5 | 
MHNEPEVAVLRYGHRPGRDDRMTTHVGLTARALGADRVILPDNAGHSMETVEDITGRFGGPFEVELTEALNGVIRNWEGRVVHLTMYGERVQDVEADIREAHAEEPLLVVVGGEKVPFEVYEGADWNVGVTNQPHSEVAGLAVFLDRLFDGRELDREWEDAENRVVPMATGKKVVPADEE
All tRNA types
| Reaction | Substrate | SubstrateType | Position | (Anti)Codon | Modified (Anti)Codon | Amino Acid Change | Transcript Name | Transcript Region | Cellular Localization | References | 
|---|---|---|---|---|---|---|---|---|---|---|
| C:Cm | tRNA (t) | tRNA/tRNA/prokaryotic cytosol | 56 | 
| Title | Authors | Journal | Details | ||
|---|---|---|---|---|---|
| RNomics and Modomics in the halophilic archaea Haloferax volcanii: identification of RNA modification genes. | Grosjean H; Gaspin C; Marck C; Decatur WA; de Crécy-Lagard V | BMC Genomics | [details] | 18844986 | 10.1186/1471-2164-9-470 |