ID Card:
    
        
            
                | Full name:  | 
                tRNA-specific adenosine deaminase subunit TAD2 | 
            
            
            
            
            
            
            
            
                | UniProt:  | 
                V5DKK8 | 
            
            
            
            
            
            
                | Complex:  | 
                Tad2/3 | 
            
            
            
            
                | Enzyme type:  | 
                 | 
            
            
                
                    |  Position of modification - modification:  | 
                    
                        
                            t:None - I  
                            
                         | 
                
                    
            
            
            
            
                | Level of experimental evidence:  | 
                5 | 
            
            
            
            
                | Level of experimental reliability:  | 
                5 | 
            
            
        
      
    
  
Protein sequence:
        
        
            
                
                    MGEGINDDKVVYCDAFMLAAFAEARAALAEGEVPVGCVLVPAEASCPANAGRLDDNNPNNSGASLGNLIAARGRNATNKEHHALAHAEFVAVEALLRDAAEKGRKPPASLAGYVLYVVVEPCIMCAAMLLYNRIKKVYFGCGNPRFGGNGTVLAVHAAKSTSAPAYESCGGHRAEEAITLLQEFYSRENSAAPDHKRRRKDI
                
                
             
         
        
Comments: 
T. cruzi ADAT2 and ADAT3 proteins form a catalytically active heterodimer similar to eukaryotic ADATs. This enzyme complex catalyzes the essential adenosine-to-inosine (A34-to-I) editing in the wobble position (position 34) of certain tRNAs,
    
        
            
            
                | Reaction | 
                Substrate | 
                SubstrateType | 
                Position | 
                (Anti)Codon | 
                Modified (Anti)Codon | 
                Amino Acid Change | 
                Transcript Name | 
                Transcript Region | 
                Cellular Localization | 
                
               
                References | 
            
            
            
            
            
                | 
                    
                    
                    
                        A:I
                    
                 | 
                
                tRNA (t) | 
                
                
                tRNA/tRNA/eukaryotic cytosol | 
                
                34 | 
                  | 
                  | 
                  | 
                  | 
                  | 
                  | 
                
                
                 | 
            
            
            
        
    
Publications:
    
    
        | Title | 
        Authors | 
        Journal | 
        Details | 
        PubMed Id | 
        DOI | 
    
    
    
    
    
        | Characterization of ADAT2/3 molecules in Trypanosoma cruzi and regulation of mucin gene expression by tRNA editing. | 
        Bertotti S; Fleming I; Cámara MLM; Centeno Cameán C; Carmona SJ; Agüero F; Balouz V; Zahn A; Di Noia JM; Alfonzo JD; Buscaglia CA | 
        Biochem J | 
        
            [details]
         | 
        
            35136964
            
         | 
        
              10.1042/BCJ20210850 
            
         |