ID Card:

Full name: tRNA-specific adenosine deaminase subunit TAD2
UniProt: Q6P6J0
Structures: | 7nz7 | 7nz8 | 7nz9 |
Complex: Tad2/3
Enzyme type:
Position of modification - modification: t:None - I
Level of experimental evidence: 2
Level of experimental reliability: 2


PDB Structures:


7nz7

Structure Description:

Title:
Classification:
Technique:

Abstract of the PDB Structure's related Publication:



Download RCSB-PDB Structures:

Pdb Files   5AP8.pdb  
Pdbx/mmCIF Files   5AP8.cif  


Protein sequence:

MEEKVESTTTPDGPCVVSVQETEKWMEEAMRMAKEALENIEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCHQHGQSPSTVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVELLKTFYKQENPNAPKSKVRKKDCQKS

Comments:

Catalyses the eukaryotic wobble adenosine-to-inosine modification as the active component of the ADAT (ADAT2/ADAT3) complex that modifies up to eight tRNAs, requiring a full tRNA for activity.




Reaction Substrate SubstrateType Position (Anti)Codon Modified (Anti)Codon Amino Acid Change Transcript Name Transcript Region Cellular Localization References
A:I tRNA (t) tRNA/tRNA/eukaryotic cytosol 34



Publications:

Title Authors Journal Details PubMed Id DOI
The structure of the mouse ADAT2/ADAT3 complex reveals the molecular basis for mammalian tRNA wobble adenosine-to-inosine deamination. Ramos-Morales E; Bayam E; Del-Pozo-Rodríguez J; Salinas-Giegé T; Marek M; Tilly P; Wolff P; Troesch E; Ennifar E; Drouard L; Godin JD; Romier C Nucleic Acids Res [details] 34057470 10.1093/nar/gkab436