Full name: | Methylenetetrahydrofolate--tRNA-(uracil-54-)-methyltransferase TrmFO |
---|---|
Synonym: | Gid, YlyC |
GI: | 3183519 |
Orf: | BSU16130 |
COG: | COG1206 |
UniProt: | P39815 |
Alpha Fold Predicted Structure: | AF-P39815-F1 |
Enzyme type: | methyltransferase |
Position of modification - modification: |
t:54 - m5U |
MNQQTVNVIGAGLAGSEAAWQLAKRGIQVKLYEMRPVKQTPAHHTDKFAELVCSNSLRSNTLANAVGVLKEEMRALDSAIIAAADECSVPAGGALAVDRHEFAASVTNRVKNHPNVTVINEEVTEIPEGPTIIATGPLTSESLSAQLKELTGEDYLYFYDAAAPIVEKDSLDMDKVYLKSRYDKGEAAYLNCPMTEEEFDRFHEALTSAETVPLKEFEKEIFFEGCMPIEVMAKRGKKTMLFGPMKPVGLEHPVTGKRPYAVVQLRQDDAAGTLYNIVGFQTHLKWGDQKEVLKLIPGLENVEIVRYGVMHRNTFINSPSLLKPTYQFKNRSDLFFAGQMTGVEGYVESAASGLVAGINAAKLVLGEELVIFPQETAIGSMAHYITTTNQKNFQPMNANFGLLKELPVKIKNKKERNEQYANRAIETIQTISKTI
In all Eukarya and many Gram-negative Bacteria, the methyl donor for this reaction is S-adenosyl-L-methionine (S-AdoMet), while in several Gram-positive Bacteria, the source of carbon is N5, N10-methylenetetrahydrofolate (CH2H4folate) . Modification in position 54 has been mapped in all tRNAs( Urbonavičius et al. 2005). Enzymatic reactions has been mapped to the MODOMICS RNA dataset. Therefore, more tRNA isoacepptors could be available.
Reaction | Substrate | SubstrateType | Position | (Anti)Codon | Modified (Anti)Codon | Amino Acid Change | Transcript Name | Transcript Region | Cellular Localization | References |
---|---|---|---|---|---|---|---|---|---|---|
U:m5U | RNA | tRNA | 54 | |||||||
U:m5U | RNA | tRNA | 54 | UGC | UGC | tRNAAlaUGC | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | GGC | GGC | tRNAAlaGGC | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | ICG | ICG | tRNAArgICG | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | UCU | UCU | tRNAArgUCU | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | CCU | CCU | tRNAArgCCU | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | CCG | CCG | tRNAArgCCG | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | GCC | GCC | tRNAGlyGCC | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | !CC | !CC | tRNAGly!CC | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | }AU | }AU | tRNAIle}AU | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | CAG | CAG | tRNALeuCAG | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | UAG | UAG | tRNALeuUAG | TΨC-loop | Cytoplasm | ||
U:m5U | RNA | tRNA | 54 | $UU | $UU | tRNALys$UU | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | CAU | CAU | tRNAMetCAU | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | #AA | #AA | tRNAPhe#AA | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | 5GG | 5GG | tRNAPro5GG | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | GCU | GCU | tRNASerGCU | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | 5GA | 5GA | tRNASer5GA | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | GGA | GGA | tRNASerGGA | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | 5GU | 5GU | tRNAThr5GU | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | CCA | CCA | tRNATrpCCA | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | QUA | QUA | tRNATyrQUA | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | 5AC | 5AC | tRNAVal5AC | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | GAC | GAC | tRNAValGAC | TΨC-loop | Prokaryotic Cytosol | ||
U:m5U | RNA | tRNA | 54 | CAU | CAU | tRNAIniCAU | TΨC-loop | Prokaryotic Cytosol |
Alpha Fold Pdb Files | AF-P39815-F1.pdb   |
Alpha Fold Pdbx/mmCIF Files | AF-P39815-F1.cif   |
DSSP Secondary Structures | P39815.dssp   |
Title | Authors | Journal | Details | ||
---|---|---|---|---|---|
Identification of a novel gene encoding a flavin-dependent tRNA:m5U methyltransferase in bacteria--evolutionary implications. | Urbonavicius J, Skouloubris S, Myllykallio H, Grosjean H | Nucleic Acids Res | [details] | 16027442 | - |
Insights into folate/FAD-dependent tRNA methyltransferase mechanism: role of two highly conserved cysteines in catalysis. | Hamdane D, Argentini M, Cornu D, Myllykallio H, Skouloubris S, Hui-Bon-Hoa G, Golinelli-Pimpaneau B | J Biol Chem | [details] | 21846722 | - |
A catalytic intermediate and several flavin redox states stabilized by folate-dependent tRNA methyltransferase from Bacillus subtilis. | Hamdane D, Guerineau V, Un S, Golinelli-Pimpaneau B | Biochemistry | [details] | 21561081 | - |
Expression and purification of untagged and histidine-tagged folate-dependent tRNA:m5U54 methyltransferase from Bacillus subtilis. | Hamdane D, Skouloubris S, Myllykallio H, Golinelli-Pimpaneau B | Protein Expr Purif | [details] | 20412857 | - |
FAD/Folate-Dependent tRNA Methyltransferase: Flavin as a new methyl-transfer agent. | Hamdane D, Argentini M, Cornu D, Golinelli-Pimpaneau B, Fontecave M... | J Am Chem Soc | [details] | 23157377 | - |
_PubMed_ |