Modomics - A Database of RNA Modifications

Full name:	Methylenetetrahydrofolate--tRNA-(uracil-54-)-methyltransferase TrmFO
Synonym:	Gid, YlyC
GI:	3183519
Orf:	BSU16130
COG:	COG1206
UniProt:	P39815
Structures:	\| \|
Complex:
Enzyme type:	methyltransferase
Position of modification - modification:	t:54 - m5U

Comments:

In all Eukarya and many Gram-negative Bacteria, the methyl donor for this reaction is S-adenosyl-L-methionine (S-AdoMet), while in several Gram-positive Bacteria, the source of carbon is N5, N10-methylenetetrahydrofolate (CH2H4folate). Crystal structures of Thermus thermophilus TrmFO in its free form, tetrahydrofolate (THF)-bound form, and glutathione-bound form at 2.1-, 1.6-, and 1.05-A resolutions were solved (see the entry for T. thermophilus TrmFO).

Protein sequence:

MNQQTVNVIGAGLAGSEAAWQLAKRGIQVKLYEMRPVKQTPAHHTDKFAELVCSNSLRSNTLANAVGVLKEEMRALDSAIIAAADECSVPAGGALAVDRH
EFAASVTNRVKNHPNVTVINEEVTEIPEGPTIIATGPLTSESLSAQLKELTGEDYLYFYDAAAPIVEKDSLDMDKVYLKSRYDKGEAAYLNCPMTEEEFD
RFHEALTSAETVPLKEFEKEIFFEGCMPIEVMAKRGKKTMLFGPMKPVGLEHPVTGKRPYAVVQLRQDDAAGTLYNIVGFQTHLKWGDQKEVLKLIPGLE
NVEIVRYGVMHRNTFINSPSLLKPTYQFKNRSDLFFAGQMTGVEGYVESAASGLVAGINAAKLVLGEELVIFPQETAIGSMAHYITTTNQKNFQPMNANF
GLLKELPVKIKNKKERNEQYANRAIETIQTISKTI

Enzymatic activities:

Reaction	Substrate	Type	Position
U:m5U	tRNA (t)	all/all/prokaryotic cytosol	54

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Identification of a novel gene encoding a flavin-dependent tRNA:m5U methyltransferase in bacteria--evolutionary implications.	Urbonavicius J, Skouloubris S, Myllykallio H, Grosjean H	Nucleic Acids Res	[details]	16027442	-
Insights into folate/FAD-dependent tRNA methyltransferase mechanism: role of two highly conserved cysteines in catalysis.	Hamdane D, Argentini M, Cornu D, Myllykallio H, Skouloubris S, Hui-Bon-Hoa G, Golinelli-Pimpaneau B	J Biol Chem	[details]	21846722	-
A catalytic intermediate and several flavin redox states stabilized by folate-dependent tRNA methyltransferase from Bacillus subtilis.	Hamdane D, Guerineau V, Un S, Golinelli-Pimpaneau B	Biochemistry	[details]	21561081	-
Expression and purification of untagged and histidine-tagged folate-dependent tRNA:m5U54 methyltransferase from Bacillus subtilis.	Hamdane D, Skouloubris S, Myllykallio H, Golinelli-Pimpaneau B	Protein Expr Purif	[details]	20412857	-
FAD/Folate-Dependent tRNA Methyltransferase: Flavin as a new methyl-transfer agent.	Hamdane D, Argentini M, Cornu D, Golinelli-Pimpaneau B, Fontecave M...	J Am Chem Soc	[details]	23157377	-

Links:

_PubMed_

_PubMed_