Modomics - A Database of RNA Modifications

Full name: Methylenetetrahydrofolate--tRNA-(uracil-54-)-methyltransferase TrmFO
Synonym: Gid, YlyC
GI: 3183519
Orf: BSU16130
COG: COG1206
UniProt: P39815
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:54 - m5U

Comments:

In all Eukarya and many Gram-negative Bacteria, the methyl donor for this reaction is S-adenosyl-L-methionine (S-AdoMet), while in several Gram-positive Bacteria, the source of carbon is N5, N10-methylenetetrahydrofolate (CH2H4folate). Crystal structures of Thermus thermophilus TrmFO in its free form, tetrahydrofolate (THF)-bound form, and glutathione-bound form at 2.1-, 1.6-, and 1.05-A resolutions were solved (see the entry for T. thermophilus TrmFO).

Protein sequence:

MNQQTVNVIGAGLAGSEAAWQLAKRGIQVKLYEMRPVKQTPAHHTDKFAELVCSNSLRSNTLANAVGVLKEEMRALDSAIIAAADECSVPAGGALAVDRH
EFAASVTNRVKNHPNVTVINEEVTEIPEGPTIIATGPLTSESLSAQLKELTGEDYLYFYDAAAPIVEKDSLDMDKVYLKSRYDKGEAAYLNCPMTEEEFD
RFHEALTSAETVPLKEFEKEIFFEGCMPIEVMAKRGKKTMLFGPMKPVGLEHPVTGKRPYAVVQLRQDDAAGTLYNIVGFQTHLKWGDQKEVLKLIPGLE
NVEIVRYGVMHRNTFINSPSLLKPTYQFKNRSDLFFAGQMTGVEGYVESAASGLVAGINAAKLVLGEELVIFPQETAIGSMAHYITTTNQKNFQPMNANF
GLLKELPVKIKNKKERNEQYANRAIETIQTISKTI

Enzymatic activities:

Reaction Substrate Type Position
U:m5U tRNA (t) all/all/prokaryotic cytosol 54

Publications:

Title Authors Journal Details PubMed Id DOI
Identification of a novel gene encoding a flavin-dependent tRNA:m5U methyltransferase in bacteria--evolutionary implications. Urbonavicius J, Skouloubris S, Myllykallio H, Grosjean H Nucleic Acids Res [details] 16027442 -
Insights into folate/FAD-dependent tRNA methyltransferase mechanism: role of two highly conserved cysteines in catalysis. Hamdane D, Argentini M, Cornu D, Myllykallio H, Skouloubris S, Hui-Bon-Hoa G, Golinelli-Pimpaneau B J Biol Chem [details] 21846722 -
A catalytic intermediate and several flavin redox states stabilized by folate-dependent tRNA methyltransferase from Bacillus subtilis. Hamdane D, Guerineau V, Un S, Golinelli-Pimpaneau B Biochemistry [details] 21561081 -
Expression and purification of untagged and histidine-tagged folate-dependent tRNA:m5U54 methyltransferase from Bacillus subtilis. Hamdane D, Skouloubris S, Myllykallio H, Golinelli-Pimpaneau B Protein Expr Purif [details] 20412857 -
FAD/Folate-Dependent tRNA Methyltransferase: Flavin as a new methyl-transfer agent. Hamdane D, Argentini M, Cornu D, Golinelli-Pimpaneau B, Fontecave M... J Am Chem Soc [details] 23157377 -

Links:

_PubMed_

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca