Modomics - A Database of RNA Modifications

Full name: Ribosomal RNA large subunit methyltransferase C
Synonym: YbgF, RumB
GI: 2501407
Orf: ybgF, b0859
COG: COG2265
UniProt: P75817
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: l:747(747) - m5U

Comments:

RlmC (formerly RumB) methylates the conserved U747 in the loop of helix 35 of domain II of the large subunit rRNA. Recombinant E.coli RlmC is inactive in vitro. However, its archaeal recombinant RlmC paralog (P. abyssi PAB0760) is active on transcript corresponding to a fragment of rRNA encompassing the hairpin 33-35. AdoMet is the methyl group donor.

Protein sequence:

MQCALYDAGRCRSCQWIMQPIPEQLSAKTADLKNLLADFPVEEWCAPVSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTPEDLCDCPLYPASFAPVFAA
LKPFIARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALPWLHEQLPQLKVITVNIQPVHMAIMEGETEIYLTEQQALAERFND
VPLWIRPQSFFQTNPAVASQLYATARDWVRQLPVKHMWDLFCGVGGFGLHCATPDMQLTGIEIASEAIACAKQSAAELGLTRLQFQALDSTQFATAQGDV
PELVLVNPPRRGIGKPLCDYLSTMAPRFIIYSSCNAQTMAKDIRELPGFRIERVQLFDMFPHTAHYEVLTLLVKQ

Enzymatic activities:

Reaction Substrate Type Position
U:m5U rRNA (r) LSU/23S/prokaryotic cytosol 747

Publications:

Title Authors Journal Details PubMed Id DOI
Identifying the methyltransferases for m(5)U747 and m(5)U1939 in 23S rRNA using MALDI mass spectrometry. Madsen CT, Mengel-Jorgensen J, Kirpekar F, Douthwaite S Nucleic Acids Res [details] 12907714 -

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca