Full name: tRNA dihydrouridine synthase C
Synonym: YohI
GI: 466094
Orf: yohI, b2140
COG: COG0042
UniProt: P33371
Structures: | 3w9z |
Complex:
Enzyme type: dihydrouridine synthase
Position of modification - modification: t:20 - D
t:20a - D
t:17 - D
t:16 - D

Comments:

DusB and DusC enzymes together introduce all D at positions 16, 17, 20, and 20a in all tRNAs, but it is not known which of them modifies which base and in which tRNA. FMN is the cofactor for the reduction reaction.

Protein sequence:

MRVLLAPMEGVLDSLVRELLTEVNDYDLCITEFVRVVDQLLPVKVFHRICPELQNASRTPSGTLVRVQLL GQFPQWLAENAARAVELGSWGVDLNCGCPSKTVNGSGGGATLLKDPELIYQGAKAMREAVPAHLPVSVKV RLGWDSGEKKFEIADAVQQAGATELVVHGRTKEQGYRAEHIDWQAIGDIRQRLNIPVIANGEIWDWQSAQ QCMAISGCDAVMIGRGALNIPNLSRVVKYNEPRMPWPEVVALLQKYTRLEKQGDTGLYHVARIKQWLSYL RKEYDEATELFQHVRVLNNSPDIARAIQAIDIEKL

Enzymatic activities:

Reaction Substrate Type Position
U:D tRNA (t)   16
U:D tRNA (t)   17
U:D tRNA (t)   20
U:D tRNA (t)   20a

Publications:

Title Authors Journal Details PubMed Id DOI
Identification of the tRNA-dihydrouridine synthase family. Bishop AC, Xu J, Johnson RC, Schimmel P, de Crecy-Lagard V J Biol Chem [details] 11983710 -
Molecular determinants of dihydrouridine synthase activity. Savage DF, de Crecy-Lagard V, Bishop AC FEBS Lett [details] 16962594 -
Molecular evolution of dihydrouridine synthases. Kasprzak JM, Czerwoniec A, Bujnicki JM... BMC Bioinformatics [details] 22741570 -
Structure of dihydrouridine synthase C (DusC) from Escherichia coli. Chen M, Yu J, Tanaka Y, Tanaka M, Tanaka I, Yao M... Acta Crystallogr Sect F Struct Biol Cryst Commun [details] 23908023 -

Links:

_Wikipedia_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto