Modomics - A Database of RNA Modifications

Full name:	tRNA dihydrouridine synthase C
Synonym:	YohI
GI:	466094
Orf:	yohI, b2140
COG:	COG0042
UniProt:	P33371
Structures:	\| 3w9z \|
Complex:
Enzyme type:	dihydrouridine synthase
Position of modification - modification:	t:20a - D t:16 - D t:20 - D t:17 - D

Comments:

DusB and DusC enzymes together introduce all D at positions 16, 17, 20, and 20a in all tRNAs, but it is not known which of them modifies which base and in which tRNA. FMN is the cofactor for the reduction reaction.

Protein sequence:

MRVLLAPMEGVLDSLVRELLTEVNDYDLCITEFVRVVDQLLPVKVFHRICPELQNASRTPSGTLVRVQLLGQFPQWLAENAARAVELGSWGVDLNCGCPS
KTVNGSGGGATLLKDPELIYQGAKAMREAVPAHLPVSVKVRLGWDSGEKKFEIADAVQQAGATELVVHGRTKEQGYRAEHIDWQAIGDIRQRLNIPVIAN
GEIWDWQSAQQCMAISGCDAVMIGRGALNIPNLSRVVKYNEPRMPWPEVVALLQKYTRLEKQGDTGLYHVARIKQWLSYLRKEYDEATELFQHVRVLNNS
PDIARAIQAIDIEKL

Enzymatic activities:

Reaction	Substrate	Position
U:D	tRNA (t)	16
U:D	tRNA (t)	17
U:D	tRNA (t)	20
U:D	tRNA (t)	20a

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Identification of the tRNA-dihydrouridine synthase family.	Bishop AC, Xu J, Johnson RC, Schimmel P, de Crecy-Lagard V	J Biol Chem	[details]	11983710	-
Molecular determinants of dihydrouridine synthase activity.	Savage DF, de Crecy-Lagard V, Bishop AC	FEBS Lett	[details]	16962594	-
Molecular evolution of dihydrouridine synthases.	Kasprzak JM, Czerwoniec A, Bujnicki JM...	BMC Bioinformatics	[details]	22741570	-
Structure of dihydrouridine synthase C (DusC) from Escherichia coli.	Chen M, Yu J, Tanaka Y, Tanaka M, Tanaka I, Yao M...	Acta Crystallogr Sect F Struct Biol Cryst Commun	[details]	23908023	-

Links:

_Wikipedia_
_PubMed_

_Wikipedia_

_PubMed_