Full name: tRNA (cytidine(32)/uridine(32)-2′-O)-methyltransferase
Synonym: YfhQ, JW2516
GI: 83287928
Orf: b2532
COG: COG0565
UniProt: P0AE01
Structures: | 4CND | 4CNE |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:32 - Um
t:32 - Cm

Comments:

AdoMet is the methyl group donor.

Protein sequence:

MLQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPDSQAIALAAGASDVIGNAHIVDTLDEAL AGCSLVVGTSARSRTLPWPMLDPRECGLKSVAEAANTPVALVFGRERVGLTNEELQKCHYHVAIAANPEY SSLNLAMAVQVIAYEVRMAWLATQENGEQVEHEETPYPLVDDLERFYGHLEQTLLATGFIRENHPGQVMN KLRRLFTRARPESQELNILRGILASIEQQNKGNKAE

Enzymatic activities:

Reaction Substrate Type Position
C:Cm tRNA (t) Ser/UGA/prokaryotic cytosol 32
C:Cm tRNA (t) Gln/CUG/prokaryotic cytosol 32
U:Um tRNA (t) Ser/UGA/prokaryotic cytosol 32
U:Um tRNA (t) Gln/CUG/prokaryotic cytosol 32

Publications:

Title Authors Journal Details PubMed Id DOI
The yfhQ gene of Escherichia coli encodes a tRNA:Cm32/Um32 methyltransferase. Purta E, van Vliet F, Tkaczuk KL, Dunin-Horkawicz S, Mori H, Droogmans L, Bujnicki JM BMC Mol Biol [details] 16848900 -
Characterization of two homologous 2'-O-methyltransferases showing different specificities for their tRNA substrates. Somme J, Van Laer B, Roovers M, Steyaert J, Versees W, Droogmans L... RNA [details] 24951554 -
tRNA recognition by a bacterial tRNA Xm32 modification enzyme from the SPOUT methyltransferase superfamily. Liu RJ, Long T, Zhou M, Zhou XL, Wang ED Nucleic Acids Res. [details] 26202969 10.1093/nar/gkv745
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto