Full name: rRNA 2′-O-methyltransferase fibrillarin
Synonym: FIB1, FLRN, fibrillarin
GI: 12056465
Orf:
COG: COG1889
UniProt: P22087
Structures: | 2IPX |
Complex: C/D RNP
Enzyme type: methyltransferase
Position of modification - modification: l:many - Xm
s:many - Xm

Comments:

FBL (fibrillarin) is a catalytic subunit of a multiprotein C/D RNP complex and homologue of S. cerevisiae Nop1 protein. It requires snoRNA to identify the substrate. The core of the complex is made of 15.5kD, Nop56 and Nop58 proteins.

Protein sequence:

MKPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNR GRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPF RSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNI IPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFA SEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN

Publications:

Title Authors Journal Details PubMed Id DOI
Evolutionary conservation of the human nucleolar protein fibrillarin and its functional expression in yeast. Jansen RP, Hurt EC, Kern H, Lehtonen H, Carmo-Fonseca M, Lapeyre B, Tollervey D J Cell Biol [details] 2026646 -
An intact Box C sequence in the U3 snRNA is required for binding of fibrillarin, the protein common to the major family of nucleolar snRNPs. Baserga SJ, Yang XD, Steitz JA EMBO J [details] 1714385 -
Human fibrillarin forms a sub-complex with splicing factor 2-associated p32, protein arginine methyltransferases, and tubulins alpha 3 and beta 1 that is independent of its association with preribosomal ribonucleoprotein complexes. Yanagida M, Hayano T, Yamauchi Y, Shinkawa T, Natsume T, Isobe T, Takahashi N J Biol Chem [details] 14583623 -
cDNA cloning and sequencing of human fibrillarin, a conserved nucleolar protein recognized by autoimmune antisera. Aris JP, Blobel G Proc Natl Acad Sci U S A [details] 1846968 -

Links:

_Wikipedia_
_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto