Full name: apolipoprotein B mRNA editing enzyme catalytic subunit 1
Synonym: BEDP,CDAR1,APOBEC-1,HEPR
GI: None
Orf: None
COG: None
UniProt: P41238
Structures: | 6x91 |
Complex: None

Comments:

None

Protein sequence:

MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKFTSERDFHPSMSCSITWFLSWSPCWECSQAI
REFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDLVNSGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQ
NHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR


Diseases connected to this enzyme:

Description Reaction Disease Name
Increased C-to-U RNA editing mediated by APOBEC1 leads to neuronal gain-of-function through presynaptic activity of RNA-edited GlyRs, resulting in facilitation of neurotransmitter release C:U
Temporal Lobe Epilepsy
C-to-U editing of NF1 RNA creates a translational stop codon, potentially leading to premature truncation of neurofibromin C:U
Neurofibromatosis
Overexpression of APOBEC1 determines aberrant editing that could contribute to the oncogenesis C:U
Hepatocellular carcinoma
APOBEC1 RNA editing is correlated to a reduction of atherosclerosis thanks to the presence of ApoB48 isoform C:U
Diabetes/obesity

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca