Modomics - A Database of RNA Modifications

Full name:	rRNA 2′-O-methyltransferase fibrillarin
Synonym:	Fibrillarin, Lot3p
GI:	6320190
Orf:	YDL014W
COG:	COG1889
UniProt:	P15646
Structures:	\| \|
Complex:	C/D RNP
Enzyme type:	methyltransferase
Position of modification - modification:	s:many - Xm l:many - Xm

Comments:

Requires snoRNA to identify the substrate. It is basically only a catalytic subunit of a multiprotein C/D RNP complex. Works in S. cerevisiae with 3 other proteins: Nop58p, Nop56p, Snu13p. About 53 positions methylated by C/D RNP complex were found in S. cerevisiae rRNA (see The yeast snoRNA database).

Protein sequence:

MSFRPGSRGGSRGGSRGGFGGRGGSRGGARGGSRGGFGGRGGSRGGARGGSRGGFGGRGGSRGGARGGSRGGRGGAAGGARGGAKVVIEPHRHAGVYIAR
GKEDLLVTKNMAPGESVYGEKRISVEEPSKEDGVPPTKVEYRVWNPFRSKLAAGIMGGLDELFIAPGKKVLYLGAASGTSVSHVSDVVGPEGVVYAVEFS
HRPGRELISMAKKRPNIIPIIEDARHPQKYRMLIGMVDCVFADVAQPDQARIIALNSHMFLKDQGGVVISIKANCIDSTVDAETVFAREVQKLREERIKP
LEQLTLEPYERDHCIVVGRYMRSGLKK

Enzymatic activities:

Reaction	Substrate	Position
A:Am	rRNA (r)	many
G:Gm	rRNA (r)	many
C:Cm	rRNA (r)	many
U:Um	rRNA (r)	many

Publications:

Title	Authors	Journal	Details	PubMed Id	DOI
Isolation and sequencing of NOP1. A yeast gene encoding a nucleolar protein homologous to a human autoimmune antigen.	Henriquez R, Blobel G, Aris JP	J Biol Chem	[details]	2298745	-
Nucleolar KKE/D repeat proteins Nop56p and Nop58p interact with Nop1p and are required for ribosome biogenesis.	Gautier T, Berges T, Tollervey D, Hurt E	Mol Cell Biol	[details]	9372940	-
The small nucleolar RNP protein NOP1 (fibrillarin) is required for pre-rRNA processing in yeast.	Tollervey D, Lehtonen H, Carmo-Fonseca M, Hurt EC	EMBO J	[details]	1825809	-
A U3 snoRNP protein with homology to splicing factor PRP4 and G beta domains is required for ribosomal RNA processing.	Jansen R, Tollervey D, Hurt EC	EMBO J	[details]	8508778	-
Box C/D snoRNP catalysed methylation is aided by additional pre-rRNA base-pairing.	van Nues RW, Granneman S, Kudla G, Sloan KE, Chicken M, Tollervey D, Watkins NJ	EMBO J	[details]	21556049	-

Links:

_Wikipedia_
_SGD_
_The yeast snoRNA database_
_PubMed_

_Wikipedia_

_SGD_

_The yeast snoRNA database_

_PubMed_