ID Card:

Full name: tRNA (cytidine/uridine/adenosine-2'-O-)-methyltransferase TrmJ
Synonym: PA14_14692
UniProt: A0A0H2ZF87
Structures: | 5GMC | 5GMB | 5GM8 |
Enzyme type:
Position of modification - modification: t:None - Cm
t:None - Um
t:None - Am
Level of experimental evidence: 3
Level of experimental reliability: 3


PDB Structures:


5GMC

Structure Description:

Title:
Classification:
Technique:

Abstract of the PDB Structure's related Publication:



Download RCSB-PDB Structures:

Pdb Files   5GM8.pdb   5GMB.pdb   5GMC.pdb  
Pdbx/mmCIF Files   5GM8.cif   5GMB.cif   5GMC.cif  


Protein sequence:

MLDRIRVVLVNTSHPGNIGGAARAMKNMGLSQLVLVQPESFPHGDAVARASGATDILDAARVVDTLEEALSGCSVVLGTSARDRRIPWPLLDPRECATTCLEHLEANGEVALVFGREYAGLTNEELQRCQFHVHIPSDPEFGSLNLAAAVQVLTYEVRMAWLAAQGKPTKMEKFESTSMLNTELVTADELELYYAHLERTLIDIGFLDPEKPRHLMSRLRRLYGRSAISKLEMNILRGILTETQKVARGLSYKRSDD

Comments:

Catalyzes the formation of 2'O-methylated cytidine (Cm32), 2'O-methylated uridine (Um32) or 2'O-methylated adenosine (Am32) at position 32 in tRNA. Confers resistance to oxidative stress.




Reaction Substrate SubstrateType Position (Anti)Codon Modified (Anti)Codon Amino Acid Change Transcript Name Transcript Region Cellular Localization References
C:Cm tRNA (t) tRNA/tRNA/prokaryotic cytosol 32
U:Um tRNA (t) tRNA/tRNA/prokaryotic cytosol 32
A:Am tRNA (t) tRNA/tRNA/prokaryotic cytosol 32



Publications:

Title Authors Journal Details PubMed Id DOI
tRNA modification profiling reveals epitranscriptome regulatory networks in Pseudomonas aeruginosa. Sun J; Wu J; Yuan Y; Fan L; Chua WLP; Ling YHS; Balamkundu S; Chay HSS; Begley TJ; de Crécy-Lagard V; Dziergowska A; Dedon PC Nucleic Acids Res [details] 40716780 10.1093/nar/gkaf696