Full name: tRNA-2′-O-methyltransferase TRM13
Synonym:
GI: 6324447
Orf: YOL125w
COG: COG2230
UniProt: Q12383
Structures: | |
Complex:
Enzyme type: methyltransferase
Position of modification - modification: t:4 - Cm
t:4 - Am

Comments:

The enzyme and the modification position is conserved in eukaryotes.

Protein sequence:

MLQDNNGPAVKRAKPSERLQCEYFMEKKKRRCGMTRSSQNLYCSEHLNLMKKAANSQVHNKNGSEAEKER ERVPCPLDPNHTVWADQLKKHLKKCNKTKLSHLNDDKPYYEPGYNGENGLLSSSVKIDITAEHLVQSIEL LYKVFEGESMDELPLRQLNNKLMSLKRFPQLPSNTKHAVQQSSLIENLVDAGAFERPESLNFIEFGCGRA EFSRYVSLYLLTQLTSLPAEHSGSNSNEFVLIDRATNRMKFDKKIKDDFSEIKSNSPSKPISCPSIKRIK IDIRDLKMDPILKSTPGDDIQYVCISKHLCGVATDLTLRCIGNSSILHGDDNNGCNPKLKAICIAMCCRH VCDYGDYVNRSYVTSLVEKYRAHGSILTYETFFRVLTKLCSWGTCGRKPGTAITDIVNVVESFEGAEPYT ITIKERENIGLMARRVIDEGRLVYVKEKFTEFNAELIRYVESDVSLENVAMLVYKK

Enzymatic activities:

Reaction Substrate Type Position
C:Cm tRNA (t) Gly/GCC/prokaryotic cytosol 4
A:Am tRNA (t) His/GUG/cytosolic 4
C:Cm tRNA (t) Pro/UGG/cytosolic 4

Publications:

Title Authors Journal Details PubMed Id DOI
The 2'-O-methyltransferase responsible for modification of yeast tRNA at position 4. Wilkinson ML, Crary SM, Jackman JE, Grayhack EJ, Phizicky EM RNA [details] 17242307 -
Trm13p, the tRNA:Xm4 modification enzyme from Saccharomyces cerevisiae is a member of the Rossmann-fold MTase superfamily: prediction of structure and active site. Tkaczuk KL... J Mol Model [details] 19697067 -

Links:

_PubMed_
_SGD_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto