Full name: YTH N6-methyladenosine RNA binding protein 1
Synonym: FLJ20391
GI: None
Orf: None
COG: None
UniProt: Q9BYJ9
Structures: | 4rci |
Complex: None

Comments:

None

Protein sequence:

MSATSVDTQRTKGQDNKVQNGSLHQKDTVHDNDFEPYLTGQSNQSNSYPSMSDPYLSSYYPPSIGFPYSLNEAPWSTAGDPPIPYLTTYGQLSNGDHHFM
HDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVVDGQPGFHSDTLSKAPGMNSLEQGMVGLKIGDVSSSAV
KTVGSVVSSVALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQ
VAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSED
DIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNK
PVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ


Diseases connected to this enzyme:

Description Reaction Disease Name
Decreased m6A levels are identified in ocular melanoma samples, indicating poor prognosis, and changes in global m6A modification are highly associated with tumor progression. Mechanistically, YTHDF1 promotes the translation of methylated mRNA of HINT2, a tumor suppressor in ocular melanoma. A:m6A
Melanoma
Mutations found in m6A regulatory genes are associated with lower OS and EFS rates in patients with AML ( Acute myeloid Leukemia) and presence of p53 mutations. A:m6A
Leukemia
YTHDF1 was found to be upregulated in HCC and to play an important role in regulating HCC cell cycle progression and metabolism. A:m6A
Hepatocellular carcinoma
The overexpressed YTHDF1, associated to DNA copy number gain, recognizes and promotes the translation of m6A-modified FZD9 and Wnt6 mRNAs, leading to an aberrant activation of Wnt/b-catenin signaling and ultimately affecting the tumorigenicity and stem cell-like activity in CRC. Epigenetic regulation by YTHDF1 plays an important role in cancer progression processes in CRC. In another study, it was demonstrated that YTHDF1 overexpression is promoted by c-Myc and is associated to CRC cells proliferation and chemoresistence. A:m6A
Colorectal cancer
"m6A-related targets were altered at protein level; overexpression of the enzymes was associated with poor prognosis on overal survival; YTHDF3 is considered independent prognosis factor for OS and relapse free survival. " A:m6A
Breast cancer

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca