Full name: Double-stranded RNA-specific editase 1
Synonym: ADAR2,DRADA2, RED1
GI: None
Orf: None
COG: None
UniProt: P78563
Structures: | 1ZY7 |
Complex: None

Comments:

None

Protein sequence:

MDIEDEENMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEIKPGLQYTLLSQ
TGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSF
SSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFNLH
LDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAEIISR
RSLLRFLYTQLELYLNNKDDQKRSIFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHEPILEGSRSYTQAGVQWCNHGSLQPRPPGLLSDPSTSTFQ
GAGTTEPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQGERLLTMSCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAM
YQRISNIEDLPPLYTLNKPLLSGISNAEARQPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHE
SKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLTP


Diseases connected to this enzyme:

Description Reaction Disease Name
RNA editing on ARPIN promotes the disease risk and is closely associated with type 2 Diabetes A:I
Type 2 Diabetes
The reduced editing at the R/G site of glutamate receptor subunits (GluRs) is likely to reduce post-synaptic excitatory responses to glutamate, thus duce post-synaptic excitatory responses to glutamate, thus limiting the progression of cell death. A:I
Spinal Cord Injury
RNA editing in GluR-B is essential for brain development to avoid the alteration of calcium permeability which affects mice seizure and survival A:I
Severe epilepsy
RNA editing inhibits the enzymatic activity of TPH2 splice variants C:U
Psychiatric disorders
5HT2C editing is altered in individuals suffering from psychiatric disorders A:I
Psychiatric disorders
RNA editing repairs the PINK1 W437amber mutation rescue the PINK1/Parkin-mediated mitophagy A:I
Parkinson
Alu-dependent RNA editing of GLI1 promotes malignant regeneration in myeloma A:I
Myeloma
ADAR has an oncogenic potential and the overexpression of the edited NEIL1 can enhance the growth and the invasion in the lung carcinoma A:I
Lung cancer
Two over-editing sites (Q103R and K96R) of CDK13, modified by ADAR, are more abundant in HCC tumor tissues and are associated with poor prognosis of HCC patients A:I
Hepatocellular carcinoma
Hypo-editing of COPA is closely associated with HCC pathogenesis and ADAR2 downregulation increased risk of liver cirrhosis and postoperative recurrence and had poor prognoses A:I
Hepatocellular carcinoma
The editing of FLNB is responsible for the ADAR-induced malignant phenotypes during ESCC progression A:I
Hepatocellular carcinoma
RNA editing increases and neutralizes a key inhibitor of the polyamine synthesis pathway, thereby promoting proliferation in vitro and increasing tumor initiation and is asscoaited with liver cirrhosis A:I
Hepatocellular carcinoma
The over-editing at the COG3 I/V site plays a critical pro-tumoral role in GBM and correlates with a worse prognosis in GBM patients A:I
Glioblastoma
Anti-tumoral: reduction of maturation of oncogenic precursors C:U
Glioblastoma
Deficiency of RNA editing in Q/R site of the GluA2 induces the loss of Ca2+ homeostasis associated with early onset epilepsy and premature death A:I
Glioblastoma
A-to-I RNA editing of the SLC22A3 gene is associated with the reduced SLC22A3 transcription and lymph node metastasis A:I
Esophageal squamous cell carcinoma
Hyper-editing of FLNB is closely associated with HCC pathogenesis and ADAR overexpression increased risk of liver cirrhosis and postoperative recurrence and had poor prognoses A:I
Esophageal squamous cell carcinoma
ADAR2 suppresses tumor growth and induces apoptosis by editing and stabilizing IGFBP7 in ESCC A:I
Esophageal squamous cell carcinoma
RNA editing inhibits the enzymatic activity of TPH2 splice variants A:I
Depression disorder
RNA editing inhibits the enzymatic activity of TPH2 splice variants C:U
Depression disorder
RNA editing inhibits the enzymatic activity of TPH2 splice variants A:I
Depression disorder
RNA editing inhibits the enzymatic activity of TPH2 splice variants C:U
Depression disorder
Edited form of RhoQ protein plays an important role in promoting the invasive potential of CRC A:I
Colorectal cancer
Increased IFN-γ pathway gene expression A:I
Chronic Myeloid Leukemia
The two edited forms of BLCAP fail to inhibit STAT3 phosphorylation indicating that A-to-I RNA editing drive anti-tumorigenic BLCAP to a loss-of-function one which might facilitate the cervical cancer initiating and progressing events A:I
Cervical cancer
RNA ‐editing of Filamin A pre‐mRNA is decreased in human cardiac disease A:I
Cardiac Disease
ADAR expression is higher in tumor compared to patient-matched normal breast tissues and cell proliferation is correlated to its activity A:I
Breast cancer
hV1.1 recoded by editing (Ile400) is altered in the intracellular side of the selectivity filter A:I
Behavioral and neurological consequences
RNA-editing enzyme ADAR2 occurs in the majority of ALS cases and causes the death of motor neurons A:I
Amiothrophic Lateral Sclerosis
Deficiency of RNA editing in Q/R site of the GluA2 induces the loss of Ca2+ homeostasis associated with early onset epilepsy and premature death A:I
Alzheimer
ADAR acts as a suppressor of type I interferon signaling A:I
Aicardi-Goutières syndrome
Splicing mutations affecting either the SH2 or PTPase domain of SHP-1 in motheaten and viable motheaten mice lead to multiple hematopoietic abnormalities, including the overexpansion and accumulation of myelomonocytic populations A:I
Acute Myeloid Leukemia

Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Andrea Cappannini - lp.vog.bcmii@ininnappaca