Full name:
Synonym: KIAA1627
GI: 24308265
Orf:
COG: COG4725
UniProt: Q9HCE5
Structures: | |
Complex: METTL3-METTL14
Enzyme type: methyltransferase
Position of modification - modification: m:many - m6A

Comments:

METTL14 is a methyltransferase which forms a stable heterodimer with METTL3. The complex mediates m6A deposition on nuclear RNA.

Protein sequence:

MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEG ETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLA DRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKC WTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAV FQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRD STIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGG TSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPR

Enzymatic activities:

Reaction Substrate Type Position
A:m6A mRNA (m) many

Publications:

Title Authors Journal Details PubMed Id DOI
A METTL3-METTL14 complex mediates mammalian nuclear RNA N-adenosine methylation. Liu J, Yue Y, Han D, Wang X, Fu Y, Zhang L, Jia G, Yu M, Lu Z, Deng X, Dai Q, Chen W, He C... Nat Chem Biol [details] 24316715 -

Links:

_PubMed_
Copyright © Genesilico - All rights reserved
If you have any advice or suggestions for corrections or improvements, please contact: Pietro Boccaletto